Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Signal peptidase complex catalytic subunit SEC11A(SEC11A)

Recombinant Human Signal peptidase complex catalytic subunit SEC11A(SEC11A)

SKU:CSB-CF020931HU

Regular price €1.457,95 EUR
Regular price Sale price €1.457,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P67812

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE

Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11A EC= 3.4.21.89 Alternative name(s): Endopeptidase SP18 Microsomal signal peptidase 18 kDa subunit Short name= SPase 18 kDa subunit SEC11 homolog A SEC11-like protein 1 SPC18

Gene Names:Name:SEC11A Synonyms:SEC11L1, SPC18, SPCS4A

Expression Region:1-179

Sequence Info:full length protein

View full details