Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Short-wave-sensitive opsin 1(OPN1SW)

Recombinant Human Short-wave-sensitive opsin 1(OPN1SW)

SKU:CSB-CF016354HU

Regular price €1.366,95 EUR
Regular price Sale price €1.366,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P03999

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

Protein Names:Recommended name: Short-wave-sensitive opsin 1 Alternative name(s): Blue cone photoreceptor pigment Blue-sensitive opsin Short name= BOP

Gene Names:Name:OPN1SW Synonyms:BCP

Expression Region:265-348

Sequence Info:Full length protein

View full details