Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Selenoprotein M(SELM)

Recombinant Human Selenoprotein M(SELM)

SKU:CSB-EP837868HUe1

Regular price €876,95 EUR
Regular price Sale price €876,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q8WWX9

Gene Names: SELM

Organism: Homo sapiens (Human)

AA Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Expression Region: 24-145aa

Sequence Info: Full Length

Source: E.coli

Tag Info: NO-tagged

MW: 13.9 kDa

Alternative Name(s):

Relevance: May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Reference: "Mammalian selenoprotein in which selenocysteine (Sec) incorporation is supported by a new form of Sec insertion sequence element." Korotkov K.V., Novoselov S.V., Hatfield D.L., Gladyshev V.N. Mol. Cell. Biol. 22:1402-1411(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details