Gene Bio Systems
Recombinant Human Ropporin-1B(ROPN1B),partial
Recombinant Human Ropporin-1B(ROPN1B),partial
SKU:CSB-EP020065HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q9BZX4
Gene Names: ROPN1B
Organism: Homo sapiens (Human)
AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Expression Region: 1-120aa
Sequence Info: Partial of Isoform 2
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 40.6 kDa
Alternative Name(s): Rhophilin-associated protein 1B
Relevance:
Reference: Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S.J. Biol. Chem. 276:17332-17338(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
