Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Retinol dehydrogenase 16(RDH16)

Recombinant Human Retinol dehydrogenase 16(RDH16)

SKU:CSB-CF019527HU

Regular price €1.598,95 EUR
Regular price Sale price €1.598,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O75452

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL

Protein Names:Recommended name: Retinol dehydrogenase 16 EC= 1.1.-.- Alternative name(s): Microsomal NAD(+)-dependent retinol dehydrogenase 4 Short name= RoDH-4 Sterol/retinol dehydrogenase

Gene Names:Name:RDH16 Synonyms:RODH4

Expression Region:1-317

Sequence Info:full length protein

View full details