Recombinant Human respiratory syncytial virus A  Small hydrophobic protein(SH)

Recombinant Human respiratory syncytial virus A Small hydrophobic protein(SH)

CSB-CF361387HPO
Regular price
€978,95 EUR
Sale price
€978,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human respiratory syncytial virus A (strain A2)

Uniprot NO.:P04852

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENTSITIEFSSKFWPYFTLIHMITTIISLLIIISIMIAILNKLCEYNVFHNKTFELPRA RVNT

Protein Names:Recommended name: Small hydrophobic protein Alternative name(s): Small protein 1A

Gene Names:Name:SH Synonyms:1A

Expression Region:1-64

Sequence Info:full length protein

Your list is ready to share