Recombinant Human Ras-related protein Rab-27B(RAB27B)

Recombinant Human Ras-related protein Rab-27B(RAB27B)

CSB-EP019178HU
Regular price
€491,95 EUR
Sale price
€491,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: O00194

Gene Names: RAB27B

Organism: Homo sapiens (Human)

AA Sequence: TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Expression Region: 2-218aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 40.5 kDa

Alternative Name(s): C25KG

Relevance: May be involved in targeting uroplakins to urothelial apical mbranes.

Reference: Molecular cloning and characterization of rab27a and rab27b, novel human rab proteins shared by melanocytes and platelets.Chen D., Guo J., Miki T., Tachibana M., Gahl W.A.Biochem. Mol. Med. 60:27-37(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share