Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative gonadotropin-releasing hormone II receptor(GNRHR2)

Recombinant Human Putative gonadotropin-releasing hormone II receptor(GNRHR2)

SKU:CSB-CF853477HU-GB

Regular price €1.464,95 EUR
Regular price Sale price €1.464,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q96P88

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAGNGTPWGSAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW SVTRREPSQLRPSPVRRLFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLK LMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVH

Protein Names:Recommended name: Putative gonadotropin-releasing hormone II receptor Short name= GnRH II receptor Short name= GnRH-II-R Alternative name(s): Type II GnRH receptor

Gene Names:Name:GNRHR2

Expression Region:1-178

Sequence Info:full length protein

View full details