Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein tyrosine phosphatase receptor type C-associated protein(PTPRCAP)

Recombinant Human Protein tyrosine phosphatase receptor type C-associated protein(PTPRCAP)

SKU:CSB-CF618909HU

Regular price €1.488,95 EUR
Regular price Sale price €1.488,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q14761

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRD SGGYYHPARLGAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVAD GGLQADPGEGEQQCGEASSPEQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDL HAFAGSAAWDDSARAAGGQGLHVTAL

Protein Names:Recommended name: Protein tyrosine phosphatase receptor type C-associated protein Short name= PTPRC-associated protein Alternative name(s): CD45-associated protein Short name= CD45-AP Lymphocyte phosphatase-associated phosphoprot

Gene Names:Name:PTPRCAP Synonyms:LPAP

Expression Region:1-206

Sequence Info:full length protein

View full details