Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein S100-A14(S100A14)

Recombinant Human Protein S100-A14(S100A14)

SKU:CSB-YP875728HU

Regular price €981,95 EUR
Regular price Sale price €981,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cancer

Target / Protein: S100A14

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q9HCY8

AA Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-104aa

Protein length: Full Length

MW: 13.7 kDa

Alternative Name(s):

Relevance:

Reference:

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details