Recombinant Human Protein S100-A1 (S100A1)

SKU: P23297

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: P23297

Gene Names: S100A1

Alternative Name(s): S-100 protein alpha chain;S-100 protein subunit alpha;S100 calcium-binding protein A1

Abbreviation: Recombinant Human S100A1 protein

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 2-94aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

MW: 26.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.

Reference: S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31: 10258-10264(1992)

Function: Probably acts as a Ca(2+) signal transducer