Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)

Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)

CSB-EP880070HU
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q9UD71

Gene Names: PPP1R1B

Organism: Homo sapiens (Human)

AA Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

Expression Region: 1-168aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 45.7 kDa

Alternative Name(s): DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein

Relevance: Inhibitor of protein-phosphatase 1.

Reference: "Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue." Brene S., Lindefors N., Ehrlich M., Taubes T., Horiuchi A., Kopp J., Hall H., Sedvall G., Greengard P., Persson H. J. Neurosci. 14:985-998(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share