Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein lifeguard 4(TMBIM4)

Recombinant Human Protein lifeguard 4(TMBIM4)

SKU:CSB-CF884516HU

Regular price €1.513,95 EUR
Regular price Sale price €1.513,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9HC24

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFE SVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYD VYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMEL VLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK

Protein Names:Recommended name: Protein lifeguard 4 Alternative name(s): Golgi anti-apoptotic protein Protein S1R Transmembrane BAX inhibitor motif-containing protein 4 Z-protein

Gene Names:Name:TMBIM4 Synonyms:GAAP, LFG4 ORF Names:CGI-119

Expression Region:1-238

Sequence Info:full length protein

View full details