Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Probable G-protein coupled receptor 132 (GPR132), partial

Recombinant Human Probable G-protein coupled receptor 132 (GPR132), partial

SKU:Q9UNW8

Regular price €673,95 EUR
Regular price Sale price €673,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: Q9UNW8

Gene Names: GPR132

Alternative Name(s): (G2 accumulation protein)

Abbreviation: Recombinant Human GPR132 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 311-380aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-GST-tagged

Target Protein Sequence: ATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC

MW: 39.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May be a receptor for oxidized free fatty acids derived from linoleic and arachidonic acids such as 9-hydroxyoctadecadienoic acid (9-HODE). Activates a G alpha protein, most likely G alpha(q). May be involved in apoptosis. Functions at the G2/M checkpoint to delay mitosis. May function as a sensor that monitors the oxidative states and mediates appropriate cellular responses such as secretion of paracrine signals and attenuation of proliferation. May mediate ths accumulation of intracellular inositol phosphates at acidic pH through proton-sensing activity.

Reference: "Identification and analysis of two splice variants of human G2A generated by alternative splicing." Ogawa A., Obinata H., Hattori T., Kishi M., Tatei K., Ishikawa O., Izumi T. J. Pharmacol. Exp. Ther. 332: 469-478(2010)

Function:

View full details