Gene Bio Systems
Recombinant Human Probable ergosterol biosynthetic protein 28(C14orf1)
Recombinant Human Probable ergosterol biosynthetic protein 28(C14orf1)
SKU:CSB-CF891729HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9UKR5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILG MLVGLRYLEVEPVSRQKKRN
Protein Names:Recommended name: Probable ergosterol biosynthetic protein 28
Gene Names:Name:C14orf1 ORF Names:AD-011, HSPC288, x0006
Expression Region:1-140
Sequence Info:full length protein
