Gene Bio Systems
Recombinant Human Platelet basic protein(PPBP) ,partial
Recombinant Human Platelet basic protein(PPBP) ,partial
SKU:CSB-RP090144h
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P02775
Gene Names: PPBP
Organism: Homo sapiens (Human)
AA Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE
Expression Region: 59-125aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 34.4 kDa
Alternative Name(s): C-X-C motif chemokine 7Leukocyte-derived growth factor ;LDGFMacrophage-derived growth factor ;MDGFSmall-inducible cytokine B7
Relevance: LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are choattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chokine-induced neutrophil activation.
Reference: Cloning of cDNA coding for connective tissue activating peptide III from a human platelet-derived lambda gt11 expression library.Wenger R.H., Wicki A.N., Walz A., Kieffer N., Clemetson K.J.Blood 73:1498-1503(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
