Recombinant Human papillomavirus type 16 Protein E7(E7) (Active)

Recombinant Human papillomavirus type 16 Protein E7(E7) (Active)

CSB-EP365855HMLg5
Regular price
€374,95 EUR
Sale price
€374,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Microbiology

Uniprot NO.:P03129

Uniprot Entry Name:

Gene Names:E7

Species:Human papillomavirus type 16

Source:E.coli

Expression Region:1-98aa

Sequence:MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Protein Description:Full Length

Tag Info:N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Mol. Weight:16.3 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 ?g/mL can bind Biotinylated MYC?CSB-EP015270HU-B?, the EC50 is 268.1-354.3 ng/mL.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Protein E7

Relevance:Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share