Gene Bio Systems
Recombinant Human p53 and DNA damage-regulated protein 1(PDRG1)
Recombinant Human p53 and DNA damage-regulated protein 1(PDRG1)
SKU:CSB-EP878890HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q9NUG6
Gene Names: PDRG1
Organism: Homo sapiens (Human)
AA Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
Expression Region: 1-133aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 31.5 kDa
Alternative Name(s):
Relevance: May play a role in chaperone-mediated protein folding.Curated
Reference: Cloning and characterization of a novel gene PDRG that is differentially regulated by p53 and ultraviolet radiation.Luo X., Huang Y., Sheikh M.S.Oncogene 22:7247-7257(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
