Gene Bio Systems
Recombinant Human Nucleoside diphosphate kinase B(NME2),partial
Recombinant Human Nucleoside diphosphate kinase B(NME2),partial
SKU:CSB-EP015886HU
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Neuroscience
Uniprot ID:P22392
Gene Names:NME2
Organism:Homo sapiens (Human)
AA Sequence:ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Expression Region:2-152aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:24.2 kDa
Alternative Name(s):C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC:2.7.13.3)) (nm23-H2) (NM23B)
Relevance:Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Exhibits histidine protein kinase activity.
Reference:"Human c-myc transcription factor PuF identified as nm23-H2 nucleoside diphosphate kinase, a candidate suppressor of tumor metastasis." Postel E.H., Berberich S.J., Flint S.J., Ferrone C.A. Science 261:478-480(1993)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically
Involvement in disease:
Subcellular Location:Cytoplasm, Nucleus, Cell projection, lamellipodium, Cell projection, ruffle
Protein Families:NDK family
Tissue Specificity:Isoform 1 and isoform 3 are ubiquitously expressed.
Paythway:
HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:7850
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=463456
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:4831
STRING Database Link:https://string-db.org/network/9606.ENSP00000376886
OMIM Database Link:https://www.omim.org/entry/156491156491156491
Lead Time Guidance:3-7 business days
