Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Novel Coronavirus Spike glycoprotein(S)(V483A),partial (Active)

Recombinant Human Novel Coronavirus Spike glycoprotein(S)(V483A),partial (Active)

SKU:CSB-MP3324GMY1(M5)

Regular price €687,95 EUR
Regular price Sale price €687,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Microbiology

Uniprot NO.:P0DTC2

Uniprot Entry Name:

Gene Names:S

Species:Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source:Mammalian cell

Expression Region:319-541aa (V483A)

Sequence:RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Protein Description:Partial

Tag Info:C-terminal 10xHis-tagged

Mol. Weight:27.8 kDa

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 ?g/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 196.4-272.1 ng/ml. ?Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 ?g/ml can bind SARS-CoV-2-S Antibody (CSB-RA33245A1GMY), the EC50 is 7.481- 18.76 ng/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

View full details