Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human NKG2-F type II integral membrane protein(KLRC4)

Recombinant Human NKG2-F type II integral membrane protein(KLRC4)

SKU:CSB-CF012469HU

Regular price €1.444,95 EUR
Regular price Sale price €1.444,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43908

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL

Protein Names:Recommended name: NKG2-F type II integral membrane protein Alternative name(s): NK cell receptor F NKG2-F-activating NK receptor

Gene Names:Name:KLRC4 Synonyms:NKG2F

Expression Region:1-158

Sequence Info:full length protein

View full details