
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: Q9NPG2
Gene Names: NGB
Organism: Homo sapiens (Human)
AA Sequence: MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Expression Region: 1-151aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 32.9 kDa
Alternative Name(s):
Relevance: Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell mbranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis.
Reference: 14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide.Jayaraman T., Tejero J., Chen B.B., Blood A.B., Frizzell S., Shapiro C., Tiso M., Hood B.L., Wang X., Zhao X., Conrads T.P., Mallampalli R.K., Gladwin M.T.J. Biol. Chem. 286:42679-42689(2011)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Cytochrome c(CYCS)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cytoglobin(CYGB)
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Amine oxidase [flavin-containing] B(MAOB),partial
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
RecombinantHumanCytochromeb-245heavychain(CYBB),partial
- Regular price
- €556,95 EUR
- Sale price
- €556,95 EUR
- Regular price
-
- Unit price
- per
Sold out