Recombinant Human Natural cytotoxicity triggering receptor 3(NCR3)

SKU: CSB-CF015551HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14931

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG

Protein Names:Recommended name: Natural cytotoxicity triggering receptor 3 Alternative name(s): Activating natural killer receptor p30 Natural killer cell p30-related protein Short name= NK-p30 Short name= NKp30 CD_antigen= CD337

Gene Names:Name:NCR3 Synonyms:1C7, LY117

Expression Region:19-201

Sequence Info:full length protein