Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Natural cytotoxicity triggering receptor 1(NCR1)

Recombinant Human Natural cytotoxicity triggering receptor 1(NCR1)

SKU:CSB-CF015549HU

Regular price €1.563,95 EUR
Regular price Sale price €1.563,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O76036

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL

Protein Names:Recommended name: Natural cytotoxicity triggering receptor 1 Alternative name(s): Lymphocyte antigen 94 homolog NK cell-activating receptor Natural killer cell p46-related protein Short name= NK-p46 Short name= NKp46 Short name= hNKp46 CD_antigen= CD335

Gene Names:Name:NCR1 Synonyms:LY94

Expression Region:22-304

Sequence Info:full length protein

View full details