Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human NADPH oxidase 4(NOX4)

Recombinant Human NADPH oxidase 4(NOX4)

SKU:CSB-CF015961HU

Regular price €1.491,95 EUR
Regular price Sale price €1.491,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NPH5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GGLLKYQTNVDTHPPGCISLNQTSSQNMSIPDYVSEHFHGSLPRGFSKLEDRYQKTLVKI CLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKE NFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPS SQDSEILPFIHSRNYPKLYIDGPFGSPFEESLNYE

Protein Names:Recommended name: NADPH oxidase 4 EC= 1.6.3.- Alternative name(s): Kidney oxidase-1 Short name= KOX-1 Kidney superoxide-producing NADPH oxidase Renal NAD(P)H-oxidase

Gene Names:Name:NOX4 Synonyms:RENOX

Expression Region:210-424

Sequence Info:full length protein

View full details