Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1(NDUFA1)

SKU: CSB-CF015618HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O15239

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 Alternative name(s): Complex I-MWFE Short name= CI-MWFE NADH-ubiquinone oxidoreductase MWFE subunit

Gene Names:Name:NDUFA1

Expression Region:1-70

Sequence Info:full length protein