Gene Bio Systems
Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform(MYLPF)
Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform(MYLPF)
SKU:CSB-EP856892HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q96A32
Gene Names: MYLPF
Organism: Homo sapiens (Human)
AA Sequence: APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Expression Region: 2-169aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 34.9 kDa
Alternative Name(s): Fast skeletal myosin light chain 2MLC2B
Relevance:
Reference: Human fast skeletal myosin light chain 2 cDNA isolation, tissue specific expression of the single copy gene, comparative sequence analysis of isoforms and evolutionary relationships.Sachdev S., Raychowdhury M.K., Sarkar S.DNA Seq. 14:339-350(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
