
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q01449
Gene Names: MYL7
Organism: Homo sapiens (Human)
AA Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Expression Region: 1-175aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 46.4 kDa
Alternative Name(s): Myosin regulatory light chain 7
Relevance:
Reference: "Differential regulation of the atrial isoforms of the myosin light chains during striated muscle development." Hailstones D.L., Barton P., Chan-Thomas P., Sutherland C.J., Hardeman E.C., Gunning P.W. J. Biol. Chem. 267:23295-23300(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Myosin regulatory light chain 2, ventricular-cardiac muscle isoform(MYL2),partial
- Regular price
- €500,95 EUR
- Sale price
- €500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform(MYLPF)
- Regular price
- €500,95 EUR
- Sale price
- €500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Myosin light chain 1-3, skeletal muscle isoform(MYL1)
- Regular price
- €500,95 EUR
- Sale price
- €500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Myosin light chain 3(MYL3)
- Regular price
- €640,95 EUR
- Sale price
- €640,95 EUR
- Regular price
-
- Unit price
- per
Sold out