Recombinant Human Myelin transcription factor 1(MYT1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Myelin transcription factor 1(MYT1),partial

CSB-RP160274h
Regular price
€613,95 EUR
Sale price
€613,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Developmental Biology

Uniprot ID: Q01538

Gene Names: MYT1

Organism: Homo sapiens (Human)

AA Sequence: GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ

Expression Region: 900-1101aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 26.1 kDa

Alternative Name(s): Myelin transcription factor I ;MyTIPLPB1;Proteolipid protein-binding protein

Relevance: Binds to the promoter regions of proteolipid proteins of the central nervous syst. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.

Reference: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Myelin expression factor 2(MYEF2),partial
    Regular price
    €613,95 EUR
    Sale price
    €613,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Myelin proteolipid protein(PLP1)
    Regular price
    €1.399,95 EUR
    Sale price
    €1.399,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Oligodendrocyte transcription factor 1(OLIG1),partial
    Regular price
    €734,95 EUR
    Sale price
    €734,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Myelin-oligodendrocyte glycoprotein(MOG),partial
    Regular price
    €446,95 EUR
    Sale price
    €446,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share