Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Metalloreductase STEAP1(STEAP1),partial

Recombinant Human Metalloreductase STEAP1(STEAP1),partial

SKU:CSB-RP133544h

Regular price €676,95 EUR
Regular price Sale price €676,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transport

Uniprot ID: Q9UHE8

Gene Names: STEAP1

Organism: Homo sapiens (Human)

AA Sequence: SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP

Expression Region: 3-69aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 35 kDa

Alternative Name(s): Six-transmembrane epithelial antigen of prostate 1

Relevance: Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor .

Reference: The Steap proteins are metalloreductases.Ohgami R.S., Campagna D.R., McDonald A., Fleming M.D.Blood 108:1388-1394(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details