Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Mammaglobin-A(SCGB2A2)

Recombinant Human Mammaglobin-A(SCGB2A2)

SKU:CSB-EP622649HU

Regular price €680,95 EUR
Regular price Sale price €680,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Tags & Cell Markers

Uniprot ID: Q13296

Gene Names: SCGB2A2

Organism: Homo sapiens (Human)

AA Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Expression Region: 1-93aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 35.5 kDa

Alternative Name(s): Mammaglobin-1 Secretoglobin family 2A member 2

Relevance:

Reference: "Mammaglobin, a mammary-specific member of the uteroglobin gene family, is overexpressed in human breast cancer." Watson M.A., Fleming T.P. Cancer Res. 56:860-865(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details