Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)

CSB-EP013246HU
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: O95868

Gene Names: LY6G6D

Organism: Homo sapiens (Human)

AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Expression Region: 20-104aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-tagged

MW: 25.5 kDa

Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein C6orf23, G6D, MEGT1, NG25

Relevance:

Reference: "Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms." Mallya M., Campbell R.D., Aguado B. Genomics 80:113-123(2002)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share