Gene Bio Systems
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
SKU:CSB-RP000474he1
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Metabolism
Target / Protein: LDHA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P00338
AA Sequence: KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Tag info: NO-tagged
Expression Region: 5-323aa
Protein length: Partial
MW: 35.1 kDa
Alternative Name(s):
Relevance: Cell proliferation-inducing gene 19 protein LDH muscle subunit
Reference: "Nucleotide sequences of the cDNA and an intronless pseudogene for human lactate dehydrogenase-A isozyme." Tsujibo H., Tiano H.F., Li S.S.-L. Eur. J. Biochem. 147:9-15(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
