Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Kunitz-type protease inhibitor 2(SPINT2)

Recombinant Human Kunitz-type protease inhibitor 2(SPINT2)

SKU:CSB-CF022585HU

Regular price €1.507,95 EUR
Regular price Sale price €1.507,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43291

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTYVL

Protein Names:Recommended name: Kunitz-type protease inhibitor 2 Alternative name(s): Hepatocyte growth factor activator inhibitor type 2 Short name= HAI-2 Placental bikunin

Gene Names:Name:SPINT2 Synonyms:HAI2, KOP

Expression Region:28-252

Sequence Info:full length protein

View full details