Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Interferon alpha-inducible protein 27, mitochondrial(IFI27)

Recombinant Human Interferon alpha-inducible protein 27, mitochondrial(IFI27)

SKU:CSB-CF011009HU-GB

Regular price €1.368,95 EUR
Regular price Sale price €1.368,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P40305

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGA TGLSGLTKFILGSIGSAIAAVIARFY

Protein Names:Recommended name: Interferon alpha-inducible protein 27, mitochondrial Short name= p27 Alternative name(s): Interferon alpha-induced 11.5 kDa protein Interferon-stimulated gene 12a protein Short name= ISG12(a)

Gene Names:Name:IFI27

Expression Region:34-119

Sequence Info:Full length protein

View full details