Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Integral membrane protein 2C(ITM2C)

Recombinant Human Integral membrane protein 2C(ITM2C)

SKU:CSB-CF011906HU

Regular price €1.551,95 EUR
Regular price Sale price €1.551,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NQX7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCY LSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKI YLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFW ELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRIN KRGAKNCNAIRHFENTFVVETLICGVV

Protein Names:Recommended name: Integral membrane protein 2C Alternative name(s): Cerebral protein 14 Transmembrane protein BRI3 Cleaved into the following chain: 1. CT-BRI3

Gene Names:Name:ITM2C Synonyms:BRI3 ORF Names:hucep-14, NPD018, PSEC0047

Expression Region:1-267

Sequence Info:full length protein

View full details