Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Insulin-like growth factor-binding protein 3 receptor(TMEM219),partial

Recombinant Human Insulin-like growth factor-binding protein 3 receptor(TMEM219),partial

SKU:CSB-EP023813HU

Regular price €650,95 EUR
Regular price Sale price €650,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:Q86XT9

Gene Names:TMEM219

Organism:Homo sapiens (Human)

AA Sequence:SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

Expression Region:39-204aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:22.7 kDa

Alternative Name(s):Transmembrane protein 219

Relevance:Cell death receptor specific for IGFBP3, may mediate caspase-8-dependent apoptosis upon ligand binding.

Reference:"IL-13Ralpha2 uses TMEM219 in chitinase 3-like-1-induced signalling and effector responses." Lee C.M., He C.H., Nour A.M., Zhou Y., Ma B., Park J.W., Kim K.H., Dela Cruz C., Sharma L., Nasr M.L., Modis Y., Lee C.G., Elias J.A. Nat Commun 7:12752-12752(2016)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details