Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial

SKU:Q86XT9

Regular price €669,95 EUR
Regular price Sale price €669,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: Q86XT9

Gene Names: TMEM219

Alternative Name(s): (IGFBP-3R)(Transmembrane protein 219)

Abbreviation: Recombinant Human TMEM219 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 39-204aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

MW: 23.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cell death receptor specific for IGFBP3, may mediate caspase-8-dependent apoptosis upon ligand binding.

Reference: "IL-13Ralpha2 uses TMEM219 in chitinase 3-like-1-induced signalling and effector responses." Lee C.M., He C.H., Nour A.M., Zhou Y., Ma B., Park J.W., Kim K.H., Dela Cruz C., Sharma L., Nasr M.L., Modis Y., Lee C.G., Elias J.A. Nat Commun 7: 12752-12752(2016)

Function:

View full details