Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial

SKU: CSB-YP008533HU

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: P30273

Gene Names: FCER1G

Organism: Homo sapiens (Human)

AA Sequence: RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Expression Region: 45-86aa

Sequence Info: Cytoplasmic Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 6.9 kDa

Alternative Name(s): Fc receptor gamma-chain ;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma ;FceRI gamma

Relevance: Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.

Reference: Characterization and expression of the gene for the human Fc receptor gamma subunit. Definition of a new gene family.Kuester H., Thompson H., Kinet J.-P.J. Biol. Chem. 265:6448-6452(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.