Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human High affinity copper uptake protein 1(SLC31A1)

Recombinant Human High affinity copper uptake protein 1(SLC31A1)

SKU:CSB-CF021575HU

Regular price €1.473,95 EUR
Regular price Sale price €1.473,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O15431

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSG LVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH KTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA VVVDITEHCH

Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Short name= hCTR1 Solute carrier family 31 member 1

Gene Names:Name:SLC31A1 Synonyms:COPT1, CTR1

Expression Region:1-190

Sequence Info:Full length protein

View full details