Gene Bio Systems
Recombinant Human herpesvirus 6B Protein U24(U24)
Recombinant Human herpesvirus 6B Protein U24(U24)
SKU:CSB-CF865554HKA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Uniprot NO.:Q9QJ42
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSSRSAWNLWNKRRKTFAF LVLTGLAIAMILFIAFVIYVFNVNRRKK
Protein Names:Recommended name: Protein U24
Gene Names:Name:U24
Expression Region:1-88
Sequence Info:full length protein
