Skip to product information
1 of 1

GeneBio Systems

Recombinant Human herpesvirus 6B G-protein coupled receptor (U12), partial

Recombinant Human herpesvirus 6B G-protein coupled receptor (U12), partial

SKU:Q9QJ51

Regular price €844,95 EUR
Regular price Sale price €844,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9QJ51

Gene Names: U12

Alternative Name(s):

Abbreviation: Recombinant Human herpesvirus 6B G-protein coupled receptor protein, partial

Organism: Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Source: E.coli

Expression Region: 1-39aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: MDTVIELSKLLHDEEFKDNASCTSTPTLKTARIIESAVT

MW: 19.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: "A strongly immunoreactive virion protein of human herpesvirus 6 variant B strain Z29: identification and characterization of the gene and mapping of a variant-specific monoclonal antibody reactive epitope." Pellett P.E., Sanchez-Martinez D., Dominguez G., Black J.B., Anton E., Greenamoyer C., Dambaugh T.R. Virology 195: 521-531(1993)

Function:

View full details