Recombinant Human herpesvirus 6A  Uncharacterized protein U15(U15)

Recombinant Human herpesvirus 6A Uncharacterized protein U15(U15)

CSB-CF718167HJZ
Regular price
€1.004,95 EUR
Sale price
€1.004,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Uniprot NO.:Q69550

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVWKRQRLQECRELCPLPVLMSLSNMFSKIEIVYVKYLFKMDFSTMYRYILPALTLSMT VTKSLVIEMLFILKRWEDIDQFFRLNIRKVNDCFIVAQFNHIPIKRWVLI

Protein Names:Recommended name: Uncharacterized protein U15

Gene Names:Name:U15 Synonyms:EFLF3

Expression Region:1-110

Sequence Info:full length protein

Your list is ready to share