Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 2 Glycoprotein N

Recombinant Human herpesvirus 2 Glycoprotein N

SKU:CSB-CF769687HJX

Regular price €1.343,95 EUR
Regular price Sale price €1.343,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Uniprot NO.:Q86539

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EPPNAAGARGVIGDAQCRGDSAGVVSVPGVLVPFYLGMTSMGVCMIAHVYQICQRALAAG SA

Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Protein UL49.5 Protein UL49A

Gene Names:

Expression Region:26-87

Sequence Info:full length protein

View full details