Gene Bio Systems
Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)
Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)
SKU:CSB-CF319168HWY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Uniprot NO.:P10229
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPLRASEHAYRPLGPGTPPMRARLPAAAWVGVGTIIGGVVIIAALVLVPSRASWALSPCD SGWHEFNLGCISWDPTPMEHEQAVGGCSAPATLIPRAAAKQLAAVARVQSARSSGYWWVS GDGIRACLRLVDGVGGIDQFCEEPALRICYYPRSPGGFVQFVTSTRNALGLP
Protein Names:Recommended name: Envelope protein UL45 Alternative name(s): 18 kDa protein
Gene Names:ORF Names:UL45
Expression Region:1-172
Sequence Info:full length protein
