Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human herpesvirus 1 Envelope glycoprotein G(gG),partial

Recombinant Human herpesvirus 1 Envelope glycoprotein G(gG),partial

SKU:CSB-EP361844HWY

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P06484

Gene Names: gG US4

Organism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

AA Sequence: VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD

Expression Region: 25-189aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.4 kDa

Alternative Name(s): gG-1

Relevance: Chokine-binding protein that inhibits neutrophils' chotaxis.

Reference: Herpes simplex virus type 1 bacterial artificial chromosome.Cunningham C., Davison A.J. Comprehensive characterization of Extracellular domain herpes simplex virus type 1 virions.Loret S., Guay G., Lippe R.J. Virol. 82:8605-8618(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details