Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1(GPIHBP1)

Recombinant Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1(GPIHBP1)

SKU:CSB-CF811603HU

Regular price €1.451,95 EUR
Regular price Sale price €1.451,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8IV16

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLT QNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPP WQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP

Protein Names:Recommended name: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 Short name= GPI-HBP1 Short name= GPI-anchored HDL-binding protein 1 Alternative name(s): High density lipoprotein-binding protein 1

Gene Names:Name:GPIHBP1 Synonyms:HBP1

Expression Region:21-184

Sequence Info:full length protein

View full details