Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Glial cell line-derived neurotrophic factor(GDNF)

Recombinant Human Glial cell line-derived neurotrophic factor(GDNF)

SKU:CSB-RP064624h

Regular price €870,95 EUR
Regular price Sale price €870,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P39905

Gene Names: GDNF

Organism: Homo sapiens (Human)

AA Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Expression Region: 78-211aa

Sequence Info: Full Length

Source: E.coli

Tag Info: NO-tagged

MW: 15.1 kDa

Alternative Name(s): Astrocyte-derived trophic factor ;ATF

Relevance: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Reference: GDNF a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons.Lin L.-F.H., Doherty D.H., Lile J.D., Bektesh S., Collins F.Science 260:1130-1132(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details