Recombinant Human Gamma-soluble NSF attachment protein(NAPG)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Gamma-soluble NSF attachment protein(NAPG)

CSB-EP860352HU
Regular price
€500,95 EUR
Sale price
€500,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q99747

Gene Names: NAPG

Organism: Homo sapiens (Human)

AA Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Expression Region: 1-312aa

Sequence Info: Full Length of BC001889

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 61.7 kDa

Alternative Name(s): N-ethylmaleimide-sensitive factor attachment protein gamma

Relevance: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Reference: "Regulated secretion in platelets: identification of elements of the platelet exocytosis machinery." Lemons P.P., Chen D., Bernstein A.M., Bennett M.K., Whiteheart S.W. Blood 90:1490-1500(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share