Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Folate receptor beta(FOLR2),partial

Recombinant Human Folate receptor beta(FOLR2),partial

SKU:CSB-BP008786HU1

Regular price €450,95 EUR
Regular price Sale price €450,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Metabolism

Uniprot ID: P14207

Gene Names: FOLR2

Organism: Homo sapiens (Human)

AA Sequence: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN

Expression Region: 19-230aa

Sequence Info: Partial

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

MW: 27.1 kDa

Alternative Name(s): Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein

Relevance: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.

Reference: "Folate coenzyme and antifolate transport proteins in normal and neoplastic cells." Freisheim J.H., Price E.M., Ratnam M. Adv. Enzyme Regul. 29:13-26(1989)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details